Lineage for d1q9mb_ (1q9m B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2736776Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2736777Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
    Uniprot Q08499 388-713
  8. 2736887Domain d1q9mb_: 1q9m B: [96289]
    complexed with rol, zn

Details for d1q9mb_

PDB Entry: 1q9m (more details), 2.3 Å

PDB Description: Three dimensional structures of PDE4D in complex with roliprams and implication on inhibitor selectivity
PDB Compounds: (B:) cAMP-specific phosphodiesterase PDE4D2

SCOPe Domain Sequences for d1q9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9mb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d1q9mb_:

Click to download the PDB-style file with coordinates for d1q9mb_.
(The format of our PDB-style files is described here.)

Timeline for d1q9mb_: