SCOPe 2.07: Domain d1q9mb_: 1q9m B:

Lineage for d1q9mb_ (1q9m B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (72 PDB entries)
   Uniprot Q08499 388-713

8. Domain d1q9mb_: 1q9m B: [96289]
   complexed with rol, zn

Details for d1q9mb_

PDB Entry: 1q9m, 2.3 Å

PDB Description: Three dimensional structures of PDE4D in complex with roliprams and implication on inhibitor selectivity

PDB Compounds: (B:) cAMP-specific phosphodiesterase PDE4D2

SCOPe Domain Sequences for d1q9mb_:

Sequence; same for both SEQRES and ATOM records:

>d1q9mb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

Timeline for d1q9mb_:

• d1q9mb_ first appeared in SCOP 1.67
  
• d1q9mb_ appears in SCOPe 2.06
  
• d1q9mb_ appears in the current release, SCOPe 2.08