PDB entry 1q9m

View 1q9m on RCSB PDB site
Description: Three dimensional structures of PDE4D in complex with roliprams and implication on inhibitor selectivity
Class: hydrolase
Keywords: PDE, rolipram, specific inhibitor, HYDROLASE
Deposited on 2003-08-25, released 2003-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific phosphodiesterase PDE4D2
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q9ma_
  • Chain 'B':
    Compound: cAMP-specific phosphodiesterase PDE4D2
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q9mb_
  • Chain 'C':
    Compound: cAMP-specific phosphodiesterase PDE4D2
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q9mc_
  • Chain 'D':
    Compound: cAMP-specific phosphodiesterase PDE4D2
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q9md_
  • Heterogens: ZN, ROL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q9mA (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9mA (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q9mB (B:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9mB (B:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q9mC (C:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9mC (C:)
    vkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtli
    tylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvd
    hpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkm
    vidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnpt
    kplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwet
    wadlvhpdaqdildtlednrewyqstipq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q9mD (D:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9mD (D:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipq