Lineage for d1q7yr_ (1q7y R:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665509Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) (S)
    many known members contain KOW motif
  5. 665510Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 665511Protein Ribosomal proteins L21e [50108] (1 species)
  7. 665512Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
  8. 665552Domain d1q7yr_: 1q7y R: [96081]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
    complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yr_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (R:) 50S ribosomal protein L21e

SCOP Domain Sequences for d1q7yr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yr_ b.34.5.1 (R:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d1q7yr_:

Click to download the PDB-style file with coordinates for d1q7yr_.
(The format of our PDB-style files is described here.)

Timeline for d1q7yr_: