Lineage for d1q7yg1 (1q7y G:1-79)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734251Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 734252Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 734253Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 734254Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 734255Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
  8. 734334Domain d1q7yg1: 1q7y G:1-79 [96069]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_

Details for d1q7yg1

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (G:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1q7yg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yg1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1q7yg1:

Click to download the PDB-style file with coordinates for d1q7yg1.
(The format of our PDB-style files is described here.)

Timeline for d1q7yg1: