Lineage for d1q7yd_ (1q7y D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669648Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 669649Protein Ribosomal protein L3 [50462] (1 species)
    superfamily fold is elaborated with additional structures
  7. 669650Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (40 PDB entries)
  8. 669690Domain d1q7yd_: 1q7y D: [96066]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
    complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yd_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (D:) 50S ribosomal protein L3P

SCOP Domain Sequences for d1q7yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yd_ b.43.3.2 (D:) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOP Domain Coordinates for d1q7yd_:

Click to download the PDB-style file with coordinates for d1q7yd_.
(The format of our PDB-style files is described here.)

Timeline for d1q7yd_: