SCOP 1.73: Domain d1q7ys_: 1q7y S:

Lineage for d1q7ys_ (1q7y S:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries)

8. Domain d1q7ys_: 1q7y S: [96082]
   Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
   complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7ys_

PDB Entry: 1q7y, 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

PDB Compounds: (S:) 50S ribosomal protein L22P

SCOP Domain Sequences for d1q7ys_:

Sequence; same for both SEQRES and ATOM records:

>d1q7ys_ d.55.1.1 (S:) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d1q7ys_:

• d1q7ys_ first appeared in SCOP 1.67
  
• d1q7ys_ appears in SCOP 1.71
  
• d1q7ys_ appears in SCOP 1.75
  
• d1q7ys_ appears in the current release, SCOPe 2.08