SCOPe 2.08: Domain d1q5vc2: 1q5v C:49-132

Lineage for d1q5vc2 (1q5v C:49-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
   automatically mapped to Pfam PF08753

6. Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)

7. Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)

8. Domain d1q5vc2: 1q5v C:49-132 [95942]
   Other proteins in same PDB: d1q5va1, d1q5vb1, d1q5vc1, d1q5vd1
   apo form
   missing some secondary structures that made up less than one-third of the common domain

Details for d1q5vc2

PDB Entry: 1q5v, 2.3 Å

PDB Description: Apo-NikR

PDB Compounds: (C:) nickel responsive regulator

SCOPe Domain Sequences for d1q5vc2:

Sequence, based on SEQRES records:

>d1q5vc2 d.58.18.4 (C:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpke

Sequence, based on observed residues (ATOM records):

>d1q5vc2 d.58.18.4 (C:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhgh
lqclpke

Timeline for d1q5vc2:

• d1q5vc2 first appeared in SCOP 1.67
  
• d1q5vc2 appears in SCOPe 2.07