Lineage for d1q5vc2 (1q5v C:49-132)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412849Superfamily d.58.18: ACT-like [55021] (4 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 412865Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)
  6. 412866Protein Nickel responsive regulator NikR, C-terminal domain [103000] (1 species)
  7. 412867Species Escherichia coli [TaxId:562] [103001] (2 PDB entries)
  8. 412874Domain d1q5vc2: 1q5v C:49-132 [95942]
    Other proteins in same PDB: d1q5va1, d1q5vb1, d1q5vc1, d1q5vd1

Details for d1q5vc2

PDB Entry: 1q5v (more details), 2.3 Å

PDB Description: Apo-NikR

SCOP Domain Sequences for d1q5vc2:

Sequence, based on SEQRES records: (download)

>d1q5vc2 d.58.18.4 (C:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpke

Sequence, based on observed residues (ATOM records): (download)

>d1q5vc2 d.58.18.4 (C:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli}
gtqgfavlsyvyehdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhgh
lqclpke

SCOP Domain Coordinates for d1q5vc2:

Click to download the PDB-style file with coordinates for d1q5vc2.
(The format of our PDB-style files is described here.)

Timeline for d1q5vc2: