PDB entry 1q5v

View 1q5v on RCSB PDB site
Description: Apo-NikR
Class: transcription
Keywords: homotetramer, ribbon-helix-helix domain, beta sandwich, TRANSCRIPTION
Deposited on 2003-08-11, released 2003-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.248
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nickel responsive regulator
    Species: Escherichia coli [TaxId:562]
    Gene: nikR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5va1, d1q5va2
  • Chain 'B':
    Compound: nickel responsive regulator
    Species: Escherichia coli [TaxId:562]
    Gene: nikR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5vb1, d1q5vb2
  • Chain 'C':
    Compound: nickel responsive regulator
    Species: Escherichia coli [TaxId:562]
    Gene: nikR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5vc1, d1q5vc2
  • Chain 'D':
    Compound: nickel responsive regulator
    Species: Escherichia coli [TaxId:562]
    Gene: nikR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q5vd1, d1q5vd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5vA (A:)
    mqrvtitldddlletldslsqrrgynnrseairdilrsalaqeatqqhgtqgfavlsyvy
    ehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrg
    vrhghlqclpked
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5vA (A:)
    mqrvtitldddlletldslsqrrgynnrseairdilrsalaqeatqhgtqgfavlsyvye
    hhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhghlqclpke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q5vB (B:)
    mqrvtitldddlletldslsqrrgynnrseairdilrsalaqeatqqhgtqgfavlsyvy
    ehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrg
    vrhghlqclpked
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5vB (B:)
    mqrvtitldddlletldslsqrrgynnrseairdilrsalaqeatqqhgtqgfavlsyvy
    ehdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhghlqclpked
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q5vC (C:)
    mqrvtitldddlletldslsqrrgynnrseairdilrsalaqeatqqhgtqgfavlsyvy
    ehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrg
    vrhghlqclpked
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5vC (C:)
    mqrvtitldddlletldslsqrrgynnrseairdilrsalaqeatqqhgtqgfavlsyvy
    ehdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhghlqclpke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q5vD (D:)
    mqrvtitldddlletldslsqrrgynnrseairdilrsalaqeatqqhgtqgfavlsyvy
    ehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrg
    vrhghlqclpked
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5vD (D:)
    mqrvtitldddlletldslsqrrynnrseairdilrsalaqeatqqhgtqgfavlsyvye
    hekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqgvr
    hghlqclpke