Lineage for d1q3qc2 (1q3q C:217-369)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389637Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 389744Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 389875Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)
  6. 389876Protein Thermosome, A-domain [52035] (4 species)
  7. 389877Species Archaeon Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102202] (4 PDB entries)
  8. 389880Domain d1q3qc2: 1q3q C:217-369 [95711]
    Other proteins in same PDB: d1q3qa1, d1q3qa3, d1q3qb1, d1q3qb3, d1q3qc1, d1q3qc3, d1q3qd1, d1q3qd3

Details for d1q3qc2

PDB Entry: 1q3q (more details), 2.3 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (two-point mutant complexed with amp-pnp)

SCOP Domain Sequences for d1q3qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3qc2 c.8.5.2 (C:217-369) Thermosome, A-domain {Archaeon Thermococcus sp. ks-1, alpha chain}
rgvvidkevvhprmpkrvenakialinealevkktetdakinitspdqlmsfleqeekml
kdmvdhiaqtganvvfvqkgiddlaqhylakygimavrrvkksdmeklakatgakivtnv
kdltpedlgyaevveerklagenmifvegcknp

SCOP Domain Coordinates for d1q3qc2:

Click to download the PDB-style file with coordinates for d1q3qc2.
(The format of our PDB-style files is described here.)

Timeline for d1q3qc2: