SCOP 1.67: Domain d1q3qb3: 1q3q B:146-216,B:370-405

Lineage for d1q3qb3 (1q3q B:146-216,B:370-405)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
   3-helical bundle packed against 3-stranded mixed beta-sheet

4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families)

5. Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)

6. Protein Thermosome, I domain [54854] (3 species)

7. Species Archaeon Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries)

8. Domain d1q3qb3: 1q3q B:146-216,B:370-405 [95709]
   Other proteins in same PDB: d1q3qa1, d1q3qa2, d1q3qb1, d1q3qb2, d1q3qc1, d1q3qc2, d1q3qd1, d1q3qd2

Details for d1q3qb3

PDB Entry: 1q3q, 2.3 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (two-point mutant complexed with amp-pnp)

SCOP Domain Sequences for d1q3qb3:

Sequence; same for both SEQRES and ATOM records:

>d1q3qb3 d.56.1.2 (B:146-216,B:370-405) Thermosome, I domain {Archaeon Thermococcus sp. ks-1, alpha chain}
vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk
agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg

Timeline for d1q3qb3:

• d1q3qb3 is new in SCOP 1.67
  
• d1q3qb3 appears in SCOP 1.69
  
• d1q3qb3 appears in the current release, SCOPe 2.08