| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) ![]() |
| Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein) |
| Protein Thermosome, A-domain [52035] (4 species) |
| Species Archaeon Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102202] (4 PDB entries) |
| Domain d1q3qb2: 1q3q B:217-369 [95708] Other proteins in same PDB: d1q3qa1, d1q3qa3, d1q3qb1, d1q3qb3, d1q3qc1, d1q3qc3, d1q3qd1, d1q3qd3 |
PDB Entry: 1q3q (more details), 2.3 Å
SCOP Domain Sequences for d1q3qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3qb2 c.8.5.2 (B:217-369) Thermosome, A-domain {Archaeon Thermococcus sp. ks-1, alpha chain}
rgvvidkevvhprmpkrvenakialinealevkktetdakinitspdqlmsfleqeekml
kdmvdhiaqtganvvfvqkgiddlaqhylakygimavrrvkksdmeklakatgakivtnv
kdltpedlgyaevveerklagenmifvegcknp
Timeline for d1q3qb2: