Lineage for d1q3qb1 (1q3q B:9-145,B:406-526)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360967Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 360968Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 361086Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein)
  6. 361087Protein Thermosome, E domain [48597] (3 species)
  7. 361088Species Archaeon Thermococcus sp. ks-1, alpha chain [TaxId:79679] [101457] (4 PDB entries)
  8. 361090Domain d1q3qb1: 1q3q B:9-145,B:406-526 [95707]
    Other proteins in same PDB: d1q3qa2, d1q3qa3, d1q3qb2, d1q3qb3, d1q3qc2, d1q3qc3, d1q3qd2, d1q3qd3

Details for d1q3qb1

PDB Entry: 1q3q (more details), 2.3 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (two-point mutant complexed with amp-pnp)

SCOP Domain Sequences for d1q3qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3qb1 a.129.1.2 (B:9-145,B:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain}
vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
alaaekaqeildeiairXavlpaggapeielairldeyakqvggkealaienfadalkii
pktlaenagldtvemlvkvisehknrglgigidvfegkpadmlekgiieplrvkkqaiks
aseaaimilriddviaaka

SCOP Domain Coordinates for d1q3qb1:

Click to download the PDB-style file with coordinates for d1q3qb1.
(The format of our PDB-style files is described here.)

Timeline for d1q3qb1: