PDB entry 1q3q

View 1q3q on RCSB PDB site
Description: Crystal structure of the chaperonin from Thermococcus strain KS-1 (two-point mutant complexed with AMP-PNP)
Deposited on 2003-07-31, released 2004-01-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q3qA (A:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3qA (A:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q3qB (B:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3qB (B:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q3qC (C:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3qC (C:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q3qD (D:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3qD (D:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka