SCOPe 2.08: Domain d1pxvc1: 1pxv C:1-109

Lineage for d1pxvc1 (1pxv C:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families)

5. Family b.61.2.2: Staphostatin [101869] (2 proteins)
   cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand

6. Protein Staphostatin B (SspC) [101872] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries)

8. Domain d1pxvc1: 1pxv C:1-109 [95303]
   Other proteins in same PDB: d1pxva1, d1pxva2, d1pxvb1, d1pxvb2, d1pxvc2, d1pxvd2
   complexed with staphopain
   complexed with gai, so4

Details for d1pxvc1

PDB Entry: 1pxv, 1.8 Å

PDB Description: the staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease

PDB Compounds: (C:) cysteine protease Inhibitor

SCOPe Domain Sequences for d1pxvc1:

Sequence; same for both SEQRES and ATOM records:

>d1pxvc1 b.61.2.2 (C:1-109) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
myqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfidt
ahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv

Timeline for d1pxvc1:

• d1pxvc1 first appeared in SCOP 1.67, called d1pxvc_
  
• d1pxvc1 appears in SCOPe 2.07