| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.1: Papain-like [54002] (26 proteins) |
| Protein Staphopain SspB [102721] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries) Uniprot Q70UQ9 41-393 |
| Domain d1pxvb1: 1pxv B:212-393 [95302] Other proteins in same PDB: d1pxva2, d1pxvb2, d1pxvc1, d1pxvc2, d1pxvd1, d1pxvd2 complexed with staphostatin B complexed with gai, so4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1pxv (more details), 1.8 Å
SCOPe Domain Sequences for d1pxvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxvb1 d.3.1.1 (B:212-393) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
hhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtly
pevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsq
npndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmi
gy
Timeline for d1pxvb1: