SCOPe 2.08: Domain d1pxvb1: 1pxv B:212-393

Lineage for d1pxvb1 (1pxv B:212-393)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Staphopain SspB [102721] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries)
   Uniprot Q70UQ9 41-393

8. Domain d1pxvb1: 1pxv B:212-393 [95302]
   Other proteins in same PDB: d1pxva2, d1pxvb2, d1pxvc1, d1pxvc2, d1pxvd1, d1pxvd2
   complexed with staphostatin B
   complexed with gai, so4
   missing some secondary structures that made up less than one-third of the common domain

Details for d1pxvb1

PDB Entry: 1pxv, 1.8 Å

PDB Description: the staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease

PDB Compounds: (B:) Cysteine protease

SCOPe Domain Sequences for d1pxvb1:

Sequence; same for both SEQRES and ATOM records:

>d1pxvb1 d.3.1.1 (B:212-393) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
hhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtly
pevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsq
npndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmi
gy

Timeline for d1pxvb1:

• d1pxvb1 first appeared in SCOP 1.67, called d1pxvb_
  
• d1pxvb1 appears in SCOPe 2.07