SCOP 1.67: Domain d1pxvc_: 1pxv C:

Lineage for d1pxvc_ (1pxv C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.61: Streptavidin-like [50875] (6 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families)

5. Family b.61.2.2: Staphostatin [101869] (2 proteins)
   cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand

6. Protein Staphostatin B (SspC) [101872] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101873] (3 PDB entries)

8. Domain d1pxvc_: 1pxv C: [95303]
   Other proteins in same PDB: d1pxva_, d1pxvb_

Details for d1pxvc_

PDB Entry: 1pxv, 1.8 Å

PDB Description: the staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease

SCOP Domain Sequences for d1pxvc_:

Sequence; same for both SEQRES and ATOM records:

>d1pxvc_ b.61.2.2 (C:) Staphostatin B (SspC) {Staphylococcus aureus}
gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv

Timeline for d1pxvc_:

• d1pxvc_ is new in SCOP 1.67
  
• d1pxvc_ appears in SCOP 1.69
  
• d1pxvc_ appears in the current release, SCOPe 2.08, called d1pxvc1