PDB entry 1pxv

View 1pxv on RCSB PDB site
Description: The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
Deposited on 2003-07-07, released 2003-10-21
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pxva_
  • Chain 'B':
    Domains in SCOP 1.67: d1pxvb_
  • Chain 'C':
    Domains in SCOP 1.67: d1pxvc_
  • Chain 'D':
    Domains in SCOP 1.67: d1pxvd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxvA (A:)
    ghhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtl
    ypevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvs
    qnpndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsm
    igy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxvB (B:)
    ghhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtl
    ypevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvs
    qnpndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsm
    igy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxvC (C:)
    gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
    dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxvD (D:)
    gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
    dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv