Lineage for d1pxvd_ (1pxv D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378912Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 379203Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families) (S)
  5. 379210Family b.61.2.2: Staphostatin [101869] (2 proteins)
    cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand
  6. 379214Protein Staphostatin B (SspC) [101872] (1 species)
  7. 379215Species Staphylococcus aureus [TaxId:1280] [101873] (3 PDB entries)
  8. 379221Domain d1pxvd_: 1pxv D: [95304]
    Other proteins in same PDB: d1pxva_, d1pxvb_
    complexed with staphopain
    complexed with gai, so4; mutant

Details for d1pxvd_

PDB Entry: 1pxv (more details), 1.8 Å

PDB Description: The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease

SCOP Domain Sequences for d1pxvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxvd_ b.61.2.2 (D:) Staphostatin B (SspC) {Staphylococcus aureus}
gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv

SCOP Domain Coordinates for d1pxvd_:

Click to download the PDB-style file with coordinates for d1pxvd_.
(The format of our PDB-style files is described here.)

Timeline for d1pxvd_: