Lineage for d1pxva1 (1pxv A:212-393)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926930Protein Staphopain SspB [102721] (1 species)
  7. 2926931Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries)
    Uniprot Q70UQ9 41-393
  8. 2926932Domain d1pxva1: 1pxv A:212-393 [95301]
    Other proteins in same PDB: d1pxva2, d1pxvb2, d1pxvc1, d1pxvc2, d1pxvd1, d1pxvd2
    complexed with staphostatin B
    complexed with gai, so4

    missing some secondary structures that made up less than one-third of the common domain

Details for d1pxva1

PDB Entry: 1pxv (more details), 1.8 Å

PDB Description: the staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
PDB Compounds: (A:) Cysteine protease

SCOPe Domain Sequences for d1pxva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxva1 d.3.1.1 (A:212-393) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
hhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtly
pevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsq
npndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmi
gy

SCOPe Domain Coordinates for d1pxva1:

Click to download the PDB-style file with coordinates for d1pxva1.
(The format of our PDB-style files is described here.)

Timeline for d1pxva1: