PDB entry 1pxv

View 1pxv on RCSB PDB site
Description: The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
Class: hydrolase
Keywords: cysteine protease inhibitor, HYDROLASE
Deposited on 2003-07-07, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine protease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: staphopain B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70UQ8 (9-182)
      • cloning artifact (0)
      • expression tag (1-6)
      • cloning artifact (7-8)
      • engineered (32)
      • see remark 999 (72)
      • see remark 999 (99)
    Domains in SCOPe 2.07: d1pxva1, d1pxva2
  • Chain 'B':
    Compound: Cysteine protease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: staphopain B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70UQ8 (9-182)
      • cloning artifact (0)
      • expression tag (1-6)
      • cloning artifact (7-8)
      • engineered (32)
      • see remark 999 (72)
      • see remark 999 (99)
    Domains in SCOPe 2.07: d1pxvb1, d1pxvb2
  • Chain 'C':
    Compound: cysteine protease Inhibitor
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: staphostatin B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYW6 (2-110)
      • cloning artifact (0-1)
      • see remark 999 (71)
    Domains in SCOPe 2.07: d1pxvc1, d1pxvc2
  • Chain 'D':
    Compound: cysteine protease Inhibitor
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: staphostatin B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYW6 (2-110)
      • cloning artifact (0-1)
      • see remark 999 (71)
    Domains in SCOPe 2.07: d1pxvd1, d1pxvd2
  • Heterogens: SO4, GAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxvA (A:)
    ghhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtl
    ypevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvs
    qnpndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsm
    igy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxvB (B:)
    ghhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtl
    ypevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvs
    qnpndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsm
    igy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxvC (C:)
    gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
    dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxvD (D:)
    gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
    dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv