Lineage for d1p7gt1 (1p7g T:12-103)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719058Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1719086Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 1719140Species Pyrobaculum aerophilum [TaxId:13773] [100984] (2 PDB entries)
  8. 1719160Domain d1p7gt1: 1p7g T:12-103 [94261]
    Other proteins in same PDB: d1p7ga2, d1p7gb2, d1p7gc2, d1p7gd2, d1p7ge2, d1p7gf2, d1p7gg2, d1p7gh2, d1p7gi2, d1p7gj2, d1p7gk2, d1p7gl2, d1p7gm2, d1p7gn2, d1p7go2, d1p7gp2, d1p7gq2, d1p7gr2, d1p7gs2, d1p7gt2, d1p7gu2, d1p7gv2, d1p7gw2, d1p7gx2
    complexed with act, bme

Details for d1p7gt1

PDB Entry: 1p7g (more details), 1.8 Å

PDB Description: Crystal structure of superoxide dismutase from Pyrobaculum aerophilum
PDB Compounds: (T:) superoxide dismutase

SCOPe Domain Sequences for d1p7gt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7gt1 a.2.11.1 (T:12-103) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
svttkrytlpplpyaynalepyisaeimqlhhqkhhqgyvnganaaleklekfrkgeaqi
diravlrdlsfhlnghilhsifwpnmappgkg

SCOPe Domain Coordinates for d1p7gt1:

Click to download the PDB-style file with coordinates for d1p7gt1.
(The format of our PDB-style files is described here.)

Timeline for d1p7gt1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7gt2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p7ga1, d1p7ga2, d1p7gb1, d1p7gb2, d1p7gc1, d1p7gc2, d1p7gd1, d1p7gd2, d1p7ge1, d1p7ge2, d1p7gf1, d1p7gf2, d1p7gg1, d1p7gg2, d1p7gh1, d1p7gh2, d1p7gi1, d1p7gi2, d1p7gj1, d1p7gj2, d1p7gk1, d1p7gk2, d1p7gl1, d1p7gl2, d1p7gm1, d1p7gm2, d1p7gn1, d1p7gn2, d1p7go1, d1p7go2, d1p7gp1, d1p7gp2, d1p7gq1, d1p7gq2, d1p7gr1, d1p7gr2, d1p7gs1, d1p7gs2, d1p7gu1, d1p7gu2, d1p7gv1, d1p7gv2, d1p7gw1, d1p7gw2, d1p7gx1, d1p7gx2