Lineage for d1p7ge2 (1p7g E:104-222)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903585Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1903613Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 1903667Species Pyrobaculum aerophilum [TaxId:13773] [102926] (2 PDB entries)
  8. 1903672Domain d1p7ge2: 1p7g E:104-222 [94232]
    Other proteins in same PDB: d1p7ga1, d1p7gb1, d1p7gc1, d1p7gd1, d1p7ge1, d1p7gf1, d1p7gg1, d1p7gh1, d1p7gi1, d1p7gj1, d1p7gk1, d1p7gl1, d1p7gm1, d1p7gn1, d1p7go1, d1p7gp1, d1p7gq1, d1p7gr1, d1p7gs1, d1p7gt1, d1p7gu1, d1p7gv1, d1p7gw1, d1p7gx1
    complexed with act, bme

Details for d1p7ge2

PDB Entry: 1p7g (more details), 1.8 Å

PDB Description: Crystal structure of superoxide dismutase from Pyrobaculum aerophilum
PDB Compounds: (E:) superoxide dismutase

SCOPe Domain Sequences for d1p7ge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ge2 d.44.1.1 (E:104-222) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
ggkpggkiadlinkffgsfekfkeefsqaaknvegvgwailvyepleeqllilqiekhnl
mhaadaqvllaldvwehayylqykndrgsyvdnwwnvvnwddverrlqkalngqialkl

SCOPe Domain Coordinates for d1p7ge2:

Click to download the PDB-style file with coordinates for d1p7ge2.
(The format of our PDB-style files is described here.)

Timeline for d1p7ge2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7ge1
View in 3D
Domains from other chains:
(mouse over for more information)
d1p7ga1, d1p7ga2, d1p7gb1, d1p7gb2, d1p7gc1, d1p7gc2, d1p7gd1, d1p7gd2, d1p7gf1, d1p7gf2, d1p7gg1, d1p7gg2, d1p7gh1, d1p7gh2, d1p7gi1, d1p7gi2, d1p7gj1, d1p7gj2, d1p7gk1, d1p7gk2, d1p7gl1, d1p7gl2, d1p7gm1, d1p7gm2, d1p7gn1, d1p7gn2, d1p7go1, d1p7go2, d1p7gp1, d1p7gp2, d1p7gq1, d1p7gq2, d1p7gr1, d1p7gr2, d1p7gs1, d1p7gs2, d1p7gt1, d1p7gt2, d1p7gu1, d1p7gu2, d1p7gv1, d1p7gv2, d1p7gw1, d1p7gw2, d1p7gx1, d1p7gx2