SCOPe 2.07: Domain d1p13b_: 1p13 B:

Lineage for d1p13b_ (1p13 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (4 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55558] (4 PDB entries)

8. Domain d1p13b_: 1p13 B: [93893]
   complexed with peptide, chains C and D
   complexed with cac

Details for d1p13b_

PDB Entry: 1p13, 1.63 Å

PDB Description: Crystal Structure of the Src SH2 Domain Complexed with Peptide (SDpYANFK)

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1p13b_:

Sequence; same for both SEQRES and ATOM records:

>d1p13b_ d.93.1.1 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp

Timeline for d1p13b_:

• d1p13b_ first appeared in SCOP 1.67
  
• d1p13b_ appears in SCOPe 2.06
  
• d1p13b_ appears in the current release, SCOPe 2.08