![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein c-src tyrosine kinase [55556] (4 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [55558] (4 PDB entries) |
![]() | Domain d1p13b_: 1p13 B: [93893] complexed with peptide, chains C and D complexed with cac |
PDB Entry: 1p13 (more details), 1.63 Å
SCOPe Domain Sequences for d1p13b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p13b_ d.93.1.1 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp
Timeline for d1p13b_: