SCOP 1.67: Domain d1p13b_: 1p13 B:

Lineage for d1p13b_ (1p13 B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (28 proteins)

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)

8. Domain d1p13b_: 1p13 B: [93893]
   complexed with peptide, chains C and D
   complexed with cac

Details for d1p13b_

PDB Entry: 1p13, 1.63 Å

PDB Description: Crystal Structure of the Src SH2 Domain Complexed with Peptide (SDpYANFK)

SCOP Domain Sequences for d1p13b_:

Sequence; same for both SEQRES and ATOM records:

>d1p13b_ d.93.1.1 (B:) c-src tyrosine kinase {Rous sarcoma virus}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp

Timeline for d1p13b_:

• d1p13b_ is new in SCOP 1.67
  
• d1p13b_ appears in SCOP 1.69
  
• d1p13b_ appears in the current release, SCOPe 2.08