Lineage for d1p13b_ (1p13 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206478Protein c-src tyrosine kinase [55556] (3 species)
  7. 2206479Species Chicken (Gallus gallus) [TaxId:9031] [55558] (4 PDB entries)
  8. 2206481Domain d1p13b_: 1p13 B: [93893]
    complexed with peptide, chains C and D
    complexed with cac

Details for d1p13b_

PDB Entry: 1p13 (more details), 1.63 Å

PDB Description: Crystal Structure of the Src SH2 Domain Complexed with Peptide (SDpYANFK)
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1p13b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p13b_ d.93.1.1 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp

SCOPe Domain Coordinates for d1p13b_:

Click to download the PDB-style file with coordinates for d1p13b_.
(The format of our PDB-style files is described here.)

Timeline for d1p13b_: