PDB entry 1p13
View 1p13 on RCSB PDB site
Description: Crystal Structure of the Src SH2 Domain Complexed with Peptide (SDpYANFK)
Class: transferase
Keywords: tyrosine-protein kinase, phosphorylation, sh3 domain, transferase
Deposited on
2003-04-11, released
2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.207
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Proto-oncogene tyrosine-protein kinase Src
Species: Gallus gallus [TaxId:9031]
Gene: SRC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1p13a_ - Chain 'B':
Compound: Proto-oncogene tyrosine-protein kinase Src
Species: Gallus gallus [TaxId:9031]
Gene: SRC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1p13b_ - Chain 'C':
Compound: peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: CAC, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1p13A (A:)
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1p13B (B:)
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.