PDB entry 1p13

View 1p13 on RCSB PDB site
Description: Crystal Structure of the Src SH2 Domain Complexed with Peptide (SDpYANFK)
Class: transferase
Keywords: tyrosine-protein kinase, phosphorylation, sh3 domain, transferase
Deposited on 2003-04-11, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p13a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p13b_
  • Chain 'C':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P13 (0-6)
  • Chain 'D':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P13 (0-6)
  • Heterogens: CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p13A (A:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p13B (B:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.