SCOPe 2.08: Domain d1oc2a_: 1oc2 A:

Lineage for d1oc2a_ (1oc2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (4 species)

7. Species Streptococcus suis, serotype 2 [TaxId:1307] [69406] (6 PDB entries)

8. Domain d1oc2a_: 1oc2 A: [92765]
   complexed with nad, so4, tdx
   has additional subdomain(s) that are not in the common domain

Details for d1oc2a_

PDB Entry: 1oc2, 1.5 Å

PDB Description: the structure of nadh in the dtdp-d-glucose dehydratase (rmlb) enzyme

PDB Compounds: (A:) dtdp-glucose 4,6-dehydratase

SCOPe Domain Sequences for d1oc2a_:

Sequence; same for both SEQRES and ATOM records:

>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]}
qfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvgd
iadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfhh
vstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgvk
atisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwailt
kgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrdel
gwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik

Timeline for d1oc2a_:

• d1oc2a_ first appeared in SCOP 1.67
  
• d1oc2a_ appears in SCOPe 2.07