PDB entry 1oc2

View 1oc2 on RCSB PDB site
Description: The structure of NADH in the dTDP-D-glucose dehydratase (RmlB) enzyme
Class: lyase
Keywords: lyase, dehydratase, nadh, rhamnose
Deposited on 2003-02-04, released 2003-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Streptococcus suis [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GIP9 (Start-347)
      • conflict (312)
    Domains in SCOPe 2.08: d1oc2a_
  • Chain 'B':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Streptococcus suis [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GIP9 (Start-347)
      • conflict (312)
    Domains in SCOPe 2.08: d1oc2b_
  • Heterogens: TDX, NAD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oc2A (A:)
    msqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvv
    gdiadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirf
    hhvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfg
    vkatisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwai
    ltkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrd
    elgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oc2A (A:)
    qfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvgd
    iadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfhh
    vstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgvk
    atisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwailt
    kgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrdel
    gwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oc2B (B:)
    msqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvv
    gdiadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirf
    hhvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfg
    vkatisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwai
    ltkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrd
    elgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oc2B (B:)
    sqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvg
    diadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfh
    hvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgv
    katisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwail
    tkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrde
    lgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik