| Class b: All beta proteins [48724] (174 folds) |
| Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily) barrel, closed; n=6, S=12; mixed beta-sheet |
Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) ![]() dimer of non-identical beta-sheet domains |
| Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins) heterodimer of two homologous chains |
| Protein Small chain TOA2, C-terminal domain [88686] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88687] (3 PDB entries) |
| Domain d1nh2d2: 1nh2 D:55-121 [91877] Other proteins in same PDB: d1nh2a1, d1nh2a2, d1nh2b_, d1nh2c_, d1nh2d1 protein/DNA complex |
PDB Entry: 1nh2 (more details), 1.9 Å
SCOPe Domain Sequences for d1nh2d2:
Sequence, based on SEQRES records: (download)
>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklriv
acnskks
>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedqsvisvdklrivacnskks
Timeline for d1nh2d2:
View in 3DDomains from other chains: (mouse over for more information) d1nh2a1, d1nh2a2, d1nh2b_, d1nh2c_ |