SCOPe 2.08: Domain d1nh2d2: 1nh2 D:55-121

Lineage for d1nh2d2 (1nh2 D:55-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
   barrel, closed; n=6, S=12; mixed beta-sheet

4. Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family)
   dimer of non-identical beta-sheet domains

5. Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
   heterodimer of two homologous chains

6. Protein Small chain TOA2, C-terminal domain [88686] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88687] (3 PDB entries)

8. Domain d1nh2d2: 1nh2 D:55-121 [91877]
   Other proteins in same PDB: d1nh2a1, d1nh2a2, d1nh2b_, d1nh2c_, d1nh2d1
   protein/DNA complex

Details for d1nh2d2

PDB Entry: 1nh2, 1.9 Å

PDB Description: crystal structure of a yeast tfiia/tbp/dna complex

PDB Compounds: (D:) Transcription initiation factor IIA small chain

SCOPe Domain Sequences for d1nh2d2:

Sequence, based on SEQRES records:

>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklriv
acnskks

Sequence, based on observed residues (ATOM records):

>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedqsvisvdklrivacnskks

Timeline for d1nh2d2:

• d1nh2d2 first appeared in SCOP 1.67
  
• d1nh2d2 appears in SCOPe 2.07