Lineage for d1nh2d1 (1nh2 D:5-54)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913510Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 913511Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family) (S)
    dimer of non-identical alpha-hairpins
  5. 913512Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
    heterodimer of two homologous chains
  6. 913519Protein Small chain TOA2, N-terminal domain [88835] (2 species)
  7. 913520Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88836] (3 PDB entries)
  8. 913521Domain d1nh2d1: 1nh2 D:5-54 [91876]
    Other proteins in same PDB: d1nh2a1, d1nh2a2, d1nh2b_, d1nh2c_, d1nh2d2
    protein/DNA complex

Details for d1nh2d1

PDB Entry: 1nh2 (more details), 1.9 Å

PDB Description: crystal structure of a yeast tfiia/tbp/dna complex
PDB Compounds: (D:) Transcription initiation factor IIA small chain

SCOPe Domain Sequences for d1nh2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nh2d1 a.32.1.1 (D:5-54) Small chain TOA2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkd

SCOPe Domain Coordinates for d1nh2d1:

Click to download the PDB-style file with coordinates for d1nh2d1.
(The format of our PDB-style files is described here.)

Timeline for d1nh2d1: