Class a: All alpha proteins [46456] (290 folds) |
Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family) dimer of non-identical alpha-hairpins |
Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins) heterodimer of two homologous chains |
Protein Small chain TOA2, N-terminal domain [88835] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88836] (3 PDB entries) |
Domain d1nh2d1: 1nh2 D:5-54 [91876] Other proteins in same PDB: d1nh2a1, d1nh2a2, d1nh2b_, d1nh2c_, d1nh2d2 protein/DNA complex |
PDB Entry: 1nh2 (more details), 1.9 Å
SCOPe Domain Sequences for d1nh2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nh2d1 a.32.1.1 (D:5-54) Small chain TOA2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkd
Timeline for d1nh2d1:
View in 3D Domains from other chains: (mouse over for more information) d1nh2a1, d1nh2a2, d1nh2b_, d1nh2c_ |