Lineage for d1nh2c_ (1nh2 C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957778Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
    barrel, closed; n=6, S=12; mixed beta-sheet
  4. 957779Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) (S)
    dimer of non-identical beta-sheet domains
  5. 957780Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
    heterodimer of two homologous chains
  6. 957781Protein Large chain TOA1, C-terminal domain [88684] (2 species)
  7. 957782Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88685] (2 PDB entries)
  8. 957783Domain d1nh2c_: 1nh2 C: [91875]
    Other proteins in same PDB: d1nh2a1, d1nh2a2, d1nh2b_, d1nh2d1, d1nh2d2
    protein/DNA complex

Details for d1nh2c_

PDB Entry: 1nh2 (more details), 1.9 Å

PDB Description: crystal structure of a yeast tfiia/tbp/dna complex
PDB Compounds: (C:) Transcription initiation factor IIA large chain

SCOPe Domain Sequences for d1nh2c_:

Sequence, based on SEQRES records: (download)

>d1nh2c_ b.56.1.1 (C:) Large chain TOA1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dylisegeedgpdenlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv

Sequence, based on observed residues (ATOM records): (download)

>d1nh2c_ b.56.1.1 (C:) Large chain TOA1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dylienlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv

SCOPe Domain Coordinates for d1nh2c_:

Click to download the PDB-style file with coordinates for d1nh2c_.
(The format of our PDB-style files is described here.)

Timeline for d1nh2c_: