SCOPe 2.08: Domain d1na6b2: 1na6 B:183-402

Lineage for d1na6b2 (1na6 B:183-402)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.22: Type II restriction endonuclease catalytic domain [102474] (1 protein)

6. Protein Restriction endonuclease EcoRII, C-terminal domain [102475] (1 species)

7. Species Escherichia coli [TaxId:562] [102476] (1 PDB entry)

8. Domain d1na6b2: 1na6 B:183-402 [91751]
   Other proteins in same PDB: d1na6a1, d1na6b1
   mutant

Details for d1na6b2

PDB Entry: 1na6, 2.1 Å

PDB Description: crystal structure of restriction endonuclease ecorii mutant r88a

PDB Compounds: (B:) Restriction endonuclease EcoRII

SCOPe Domain Sequences for d1na6b2:

Sequence; same for both SEQRES and ATOM records:

>d1na6b2 c.52.1.22 (B:183-402) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]}
yilpedwhlrfpsgseiiqyaashyvknsldpdeqlldrrrveydifllveelhvldiir
kgfgsvdefialansvsnrrksragkslelhlehlfiehglrhfatqaitegnkkpdflf
psagayhdtefpvenlrmlavkttckdrwrqilneadkihqvhlftlqegvslaqyremr
esgvrlvvpsslhkkypeavraelmtlgafiaeltglyad

Timeline for d1na6b2:

• d1na6b2 first appeared in SCOP 1.67
  
• d1na6b2 appears in SCOPe 2.07