![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.142: DNA-binding pseudobarrel domain [101935] (1 superfamily) core: barrel, open; n=7, S*=10; capped with helices at both ends; partial similarity to the AbrB/MazE/MraZ-like fold (89446) |
![]() | Superfamily b.142.1: DNA-binding pseudobarrel domain [101936] (2 families) ![]() |
![]() | Family b.142.1.1: Type II restriction endonuclease effector domain [101937] (1 protein) automatically mapped to Pfam PF09217 |
![]() | Protein Restriction endonuclease EcoRII, N-terminal domain [101938] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [101939] (1 PDB entry) |
![]() | Domain d1na6b1: 1na6 B:4-178 [91750] Other proteins in same PDB: d1na6a2, d1na6b2 mutant |
PDB Entry: 1na6 (more details), 2.1 Å
SCOPe Domain Sequences for d1na6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1na6b1 b.142.1.1 (B:4-178) Restriction endonuclease EcoRII, N-terminal domain {Escherichia coli [TaxId: 562]} svfhnwlleiacenyfvyikrlsandtgatgghqvglyipsgiveklfpsinhtrelnps vfltahvsshdcpdsearaiyynsahfgktrnekritrwgrgsplqdpentgaltllafk ldeqggdckevniwvcastdeedvietaigevipgalisgpagqilgglslqqap
Timeline for d1na6b1: