Lineage for d1na6a2 (1na6 A:179-398)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121489Family c.52.1.22: Type II restriction endonuclease catalytic domain [102474] (1 protein)
  6. 2121490Protein Restriction endonuclease EcoRII, C-terminal domain [102475] (1 species)
  7. 2121491Species Escherichia coli [TaxId:562] [102476] (1 PDB entry)
  8. 2121492Domain d1na6a2: 1na6 A:179-398 [91749]
    Other proteins in same PDB: d1na6a1, d1na6b1
    mutant

Details for d1na6a2

PDB Entry: 1na6 (more details), 2.1 Å

PDB Description: Crystal structure of restriction endonuclease EcoRII mutant R88A
PDB Compounds: (A:) Restriction endonuclease EcoRII

SCOPe Domain Sequences for d1na6a2:

Sequence, based on SEQRES records: (download)

>d1na6a2 c.52.1.22 (A:179-398) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]}
vnhkyilpedwhlrfpsgseiiqyaashyvknsldpdeqlldrrrveydifllveelhvl
diirkgfgsvdefialansvsnrrksragkslelhlehlfiehglrhfatqaitegnkkp
dflfpsagayhdtefpvenlrmlavkttckdrwrqilneadkihqvhlftlqegvslaqy
remresgvrlvvpsslhkkypeavraelmtlgafiaeltg

Sequence, based on observed residues (ATOM records): (download)

>d1na6a2 c.52.1.22 (A:179-398) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]}
vnhkyilpedwhlrfpsgseiiqyaashydpdeqlldrrrveydifllveelhvldiirk
gfgsvdefialansvsnrrksragkslelhlehlfiehglrhfatqapdflfpsagayhp
lrmlavkttckdrwrqilnhlftlqegvslaqyremresgvrlvvpsslhkkypeavrae
lmtlgafiaeltg

SCOPe Domain Coordinates for d1na6a2:

Click to download the PDB-style file with coordinates for d1na6a2.
(The format of our PDB-style files is described here.)

Timeline for d1na6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1na6a1