PDB entry 1na6

View 1na6 on RCSB PDB site
Description: Crystal structure of restriction endonuclease EcoRII mutant R88A
Class: hydrolase
Keywords: site-specific restriction; mutation; REPLICATION, HYDROLASE
Deposited on 2002-11-26, released 2003-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.23
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Restriction endonuclease EcoRII
    Species: Escherichia coli [TaxId:562]
    Gene: EcoRII
    Database cross-references and differences (RAF-indexed):
    • GB CAA12280
      • engineered (87)
    Domains in SCOPe 2.08: d1na6a1, d1na6a2
  • Chain 'B':
    Compound: Restriction endonuclease EcoRII
    Species: Escherichia coli [TaxId:562]
    Gene: EcoRII
    Database cross-references and differences (RAF-indexed):
    • GB CAA12280
      • engineered (87)
    Domains in SCOPe 2.08: d1na6b1, d1na6b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1na6A (A:)
    mlmsvfhnwlleiacenyfvyikrlsandtgatgghqvglyipsgiveklfpsinhtrel
    npsvfltahvsshdcpdsearaiyynsahfgktrnekritrwgrgsplqdpentgaltll
    afkldeqggdckevniwvcastdeedvietaigevipgalisgpagqilgglslqqapvn
    hkyilpedwhlrfpsgseiiqyaashyvknsldpdeqlldrrrveydifllveelhvldi
    irkgfgsvdefialansvsnrrksragkslelhlehlfiehglrhfatqaitegnkkpdf
    lfpsagayhdtefpvenlrmlavkttckdrwrqilneadkihqvhlftlqegvslaqyre
    mresgvrlvvpsslhkkypeavraelmtlgafiaeltglyadip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1na6A (A:)
    svfhnwlleiacenyfvyikrlsandtgatqvglyipsgiveklfpsinhtrelnpsvfl
    tahvsshdcpdsearaiyynsahfgktrnekritrwgrgsplqdpentgaltllafklde
    qggdckevniwvcastdeedvietaigevipgalisgpagqilgglslqqapvnhkyilp
    edwhlrfpsgseiiqyaashydpdeqlldrrrveydifllveelhvldiirkgfgsvdef
    ialansvsnrrksragkslelhlehlfiehglrhfatqapdflfpsagayhplrmlavkt
    tckdrwrqilnhlftlqegvslaqyremresgvrlvvpsslhkkypeavraelmtlgafi
    aeltg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1na6B (B:)
    mlmsvfhnwlleiacenyfvyikrlsandtgatgghqvglyipsgiveklfpsinhtrel
    npsvfltahvsshdcpdsearaiyynsahfgktrnekritrwgrgsplqdpentgaltll
    afkldeqggdckevniwvcastdeedvietaigevipgalisgpagqilgglslqqapvn
    hkyilpedwhlrfpsgseiiqyaashyvknsldpdeqlldrrrveydifllveelhvldi
    irkgfgsvdefialansvsnrrksragkslelhlehlfiehglrhfatqaitegnkkpdf
    lfpsagayhdtefpvenlrmlavkttckdrwrqilneadkihqvhlftlqegvslaqyre
    mresgvrlvvpsslhkkypeavraelmtlgafiaeltglyadip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1na6B (B:)
    svfhnwlleiacenyfvyikrlsandtgatgghqvglyipsgiveklfpsinhtrelnps
    vfltahvsshdcpdsearaiyynsahfgktrnekritrwgrgsplqdpentgaltllafk
    ldeqggdckevniwvcastdeedvietaigevipgalisgpagqilgglslqqapyilpe
    dwhlrfpsgseiiqyaashyvknsldpdeqlldrrrveydifllveelhvldiirkgfgs
    vdefialansvsnrrksragkslelhlehlfiehglrhfatqaitegnkkpdflfpsaga
    yhdtefpvenlrmlavkttckdrwrqilneadkihqvhlftlqegvslaqyremresgvr
    lvvpsslhkkypeavraelmtlgafiaeltglyad