Lineage for d1mw4a_ (1mw4 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035347Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1035348Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1035349Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1035559Protein Growth factor receptor-bound protein 7 [103135] (1 species)
  7. 1035560Species Human (Homo sapiens) [TaxId:9606] [103136] (2 PDB entries)
  8. 1035565Domain d1mw4a_: 1mw4 A: [91476]

Details for d1mw4a_

PDB Entry: 1mw4 (more details)

PDB Description: Solution structure of the human Grb7-SH2 domain in complex with a 10 amino acid peptide pY1139
PDB Compounds: (A:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d1mw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mw4a_ d.93.1.1 (A:) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]}
gspasgtslsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslc
hlqkvkhylilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval

SCOPe Domain Coordinates for d1mw4a_:

Click to download the PDB-style file with coordinates for d1mw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1mw4a_: