Lineage for d1mw4a_ (1mw4 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415905Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 415906Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 415907Family d.93.1.1: SH2 domain [55551] (28 proteins)
  6. 416055Protein Growth factor receptor-bound protein 7 [103135] (1 species)
  7. 416056Species Human (Homo sapiens) [TaxId:9606] [103136] (1 PDB entry)
  8. 416057Domain d1mw4a_: 1mw4 A: [91476]

Details for d1mw4a_

PDB Entry: 1mw4 (more details)

PDB Description: Solution structure of the human Grb7-SH2 domain in complex with a 10 amino acid peptide pY1139

SCOP Domain Sequences for d1mw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mw4a_ d.93.1.1 (A:) Growth factor receptor-bound protein 7 {Human (Homo sapiens)}
gspasgtslsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslc
hlqkvkhylilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval

SCOP Domain Coordinates for d1mw4a_:

Click to download the PDB-style file with coordinates for d1mw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1mw4a_: