Lineage for d1mw4a1 (1mw4 A:3-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965460Protein Growth factor receptor-bound protein 7 [103135] (1 species)
  7. 2965461Species Human (Homo sapiens) [TaxId:9606] [103136] (4 PDB entries)
  8. 2965469Domain d1mw4a1: 1mw4 A:3-120 [91476]
    Other proteins in same PDB: d1mw4a2

Details for d1mw4a1

PDB Entry: 1mw4 (more details)

PDB Description: Solution structure of the human Grb7-SH2 domain in complex with a 10 amino acid peptide pY1139
PDB Compounds: (A:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d1mw4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mw4a1 d.93.1.1 (A:3-120) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]}
pasgtslsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslchl
qkvkhylilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval

SCOPe Domain Coordinates for d1mw4a1:

Click to download the PDB-style file with coordinates for d1mw4a1.
(The format of our PDB-style files is described here.)

Timeline for d1mw4a1: