Lineage for d1moxa2 (1mox A:312-480)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851793Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2851794Protein EGF receptor extracellular domain [82326] (1 species)
  7. 2851795Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)
  8. 2851808Domain d1moxa2: 1mox A:312-480 [91373]
    Other proteins in same PDB: d1moxa3, d1moxa4, d1moxb3, d1moxb4, d1moxc_, d1moxd_
    complexed with TGF-alpha
    complexed with cd, cl, nag, pt

Details for d1moxa2

PDB Entry: 1mox (more details), 2.5 Å

PDB Description: crystal structure of human epidermal growth factor receptor (residues 1-501) in complex with tgf-alpha
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1moxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moxa2 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil
ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke
isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOPe Domain Coordinates for d1moxa2:

Click to download the PDB-style file with coordinates for d1moxa2.
(The format of our PDB-style files is described here.)

Timeline for d1moxa2: