SCOPe 2.08: Domain d1moxc

Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds)
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families)
Family g.3.11.1: EGF-type module [57197] (23 proteins)
Protein Transforming growth factor alpha [57217] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [57218] (7 PDB entries)
Domain d1moxc_: 1mox C: [91380]
Other proteins in same PDB: d1moxa1, d1moxa2, d1moxa3, d1moxa4, d1moxb1, d1moxb2, d1moxb3, d1moxb4
complexed with EGF receptor
complexed with cd, cl, nag, pt

PDB Entry: 1mox (more details), 2.5 Å

PDB Description: crystal structure of human epidermal growth factor receptor (residues 1-501) in complex with tgf-alpha

PDB Compounds: (C:) transforming growth factor alpha

SCOPe Domain Sequences for d1moxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}
vshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOPe Domain Coordinates for d1moxc_:

Click to download the PDB-style file with coordinates for d1moxc_.
(The format of our PDB-style files is described here.)

Timeline for d1moxc_:

Thumbnails for d1moxc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1moxa1, d1moxa2, d1moxa3, d1moxa4, d1moxb1, d1moxb2, d1moxb3, d1moxb4, d1moxd_