PDB entry 1mox

View 1mox on RCSB PDB site
Description: Crystal Structure of Human Epidermal Growth Factor Receptor (residues 1-501) in complex with TGF-alpha
Class: transferase/growth factor
Keywords: EGFR, Receptor, Complex, Growth Factor, transferase-growth factor COMPLEX
Deposited on 2002-09-10, released 2003-09-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1moxa1, d1moxa2, d1moxa3, d1moxa4
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1moxb1, d1moxb2, d1moxb3, d1moxb4
  • Chain 'C':
    Compound: transforming growth factor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1moxc_
  • Chain 'D':
    Compound: transforming growth factor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1moxd_
  • Heterogens: NAG, PT, CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1moxA (A:)
    leekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqe
    vagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeil
    hgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgage
    encqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtc
    pplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvr
    kckkcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsftht
    ppldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvsln
    itslglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
    vchalcspegcwgpeprdcvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1moxA (A:)
    leekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqe
    vagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeil
    hgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgage
    encqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtc
    pplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvr
    kckkcgpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtp
    pldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslni
    tslglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqv
    chalcspegcwgpeprdcv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1moxB (B:)
    leekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqe
    vagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeil
    hgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgage
    encqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtc
    pplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvr
    kckkcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsftht
    ppldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvsln
    itslglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
    vchalcspegcwgpeprdcvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1moxC (C:)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1moxC (C:)
    vshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1moxD (D:)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1moxD (D:)
    shfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla