Lineage for d1ixla_ (1ixl A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511612Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2511613Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2511928Family d.38.1.5: PaaI/YdiI-like [89902] (15 protein domains)
  6. 2511962Protein Hypothetical protein PH1136 [102916] (1 species)
  7. 2511963Species Pyrococcus horikoshii [TaxId:53953] [102917] (1 PDB entry)
  8. 2511964Domain d1ixla_: 1ixl A: [90717]
    structural genomics

Details for d1ixla_

PDB Entry: 1ixl (more details), 1.94 Å

PDB Description: Crystal structure of uncharacterized protein PH1136 from Pyrococcus horikoshii
PDB Compounds: (A:) hypothetical protein PH1136

SCOPe Domain Sequences for d1ixla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Pyrococcus horikoshii [TaxId: 53953]}
mipveqrthkltsrilvgkpilikegyaeveletidemkvdekglvhggftfgladyaam
lavneptvvlgkaevrftkpvkvgdklvakakiiedlgkkkivevkvyreeevvlegkfy
cyvlekhvld

SCOPe Domain Coordinates for d1ixla_:

Click to download the PDB-style file with coordinates for d1ixla_.
(The format of our PDB-style files is described here.)

Timeline for d1ixla_: