![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (6 proteins) |
![]() | Protein Hypothetical protein PH1136 [102916] (1 species) |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102917] (1 PDB entry) |
![]() | Domain d1ixla_: 1ixl A: [90717] structural genomics |
PDB Entry: 1ixl (more details), 1.94 Å
SCOP Domain Sequences for d1ixla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii} mipveqrthkltsrilvgkpilikegyaeveletidemkvdekglvhggftfgladyaam lavneptvvlgkaevrftkpvkvgdklvakakiiedlgkkkivevkvyreeevvlegkfy cyvlekhvld
Timeline for d1ixla_: