SCOP 1.67: Domain d1ixla_: 1ixl A:

Lineage for d1ixla_ (1ixl A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (6 proteins)

6. Protein Hypothetical protein PH1136 [102916] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102917] (1 PDB entry)

8. Domain d1ixla_: 1ixl A: [90717]
   structural genomics

Details for d1ixla_

PDB Entry: 1ixl, 1.94 Å

PDB Description: Crystal structure of uncharacterized protein PH1136 from Pyrococcus horikoshii

SCOP Domain Sequences for d1ixla_:

Sequence; same for both SEQRES and ATOM records:

>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii}
mipveqrthkltsrilvgkpilikegyaeveletidemkvdekglvhggftfgladyaam
lavneptvvlgkaevrftkpvkvgdklvakakiiedlgkkkivevkvyreeevvlegkfy
cyvlekhvld

Timeline for d1ixla_:

• d1ixla_ is new in SCOP 1.67
  
• d1ixla_ appears in SCOP 1.69
  
• d1ixla_ appears in the current release, SCOPe 2.08