Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
Protein Hypothetical protein PH1136 [102916] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [102917] (1 PDB entry) |
Domain d1ixla_: 1ixl A: [90717] structural genomics |
PDB Entry: 1ixl (more details), 1.94 Å
SCOPe Domain Sequences for d1ixla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Pyrococcus horikoshii [TaxId: 53953]} mipveqrthkltsrilvgkpilikegyaeveletidemkvdekglvhggftfgladyaam lavneptvvlgkaevrftkpvkvgdklvakakiiedlgkkkivevkvyreeevvlegkfy cyvlekhvld
Timeline for d1ixla_: