PDB entry 1ixl

View 1ixl on RCSB PDB site
Description: Crystal structure of uncharacterized protein PH1136 from Pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: alpha+beta, hot-dog-fold, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2002-06-27, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1136
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58863 (0-End)
      • modified residue (0)
      • modified residue (37)
      • modified residue (59)
    Domains in SCOPe 2.08: d1ixla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ixlA (A:)
mipveqrthkltsrilvgkpilikegyaeveletidemkvdekglvhggftfgladyaam
lavneptvvlgkaevrftkpvkvgdklvakakiiedlgkkkivevkvyreeevvlegkfy
cyvlekhvldn

    Sequence, based on observed residues (ATOM records): (download) 
    >1ixlA (A:)
mipveqrthkltsrilvgkpilikegyaeveletidemkvdekglvhggftfgladyaam
lavneptvvlgkaevrftkpvkvgdklvakakiiedlgkkkivevkvyreeevvlegkfy
cyvlekhvld