Lineage for d1hx8b2 (1hx8 B:22-162)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727121Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins)
  6. 2727122Protein AP180 (Lap) [100914] (1 species)
  7. 2727123Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [100915] (1 PDB entry)
  8. 2727125Domain d1hx8b2: 1hx8 B:22-162 [90365]
    Other proteins in same PDB: d1hx8a1, d1hx8b1
    complexed with so4

Details for d1hx8b2

PDB Entry: 1hx8 (more details), 2.2 Å

PDB Description: crystal structure of n-terminal domain of drosophila ap180
PDB Compounds: (B:) synapse-enriched clathrin adaptor protein lap

SCOPe Domain Sequences for d1hx8b2:

Sequence, based on SEQRES records: (download)

>d1hx8b2 a.118.9.3 (B:22-162) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
itthhlmaygnerfmqylassnstfnlssfldkgtvqdggmgvpggrmgydmspfirrya
kylnekslsyramafdfckvk

Sequence, based on observed residues (ATOM records): (download)

>d1hx8b2 a.118.9.3 (B:22-162) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
itthhlmaygnerfmqylassnstfnlssfldkgtmgvpggrmgydmspfirryakylne
kslsyramafdfckvk

SCOPe Domain Coordinates for d1hx8b2:

Click to download the PDB-style file with coordinates for d1hx8b2.
(The format of our PDB-style files is described here.)

Timeline for d1hx8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hx8b1